PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0145s0250.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1150aa    MW: 130217 Da    PI: 7.2005
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0145s0250.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-09553856
                            -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                            ++ ql++L +++++++yps +++e+LA   +Lt +qV+ WF  +R  +k
  SapurV1A.0145s0250.2.p  5 SQLQLQTLLKFYAEDKYPSPRAMEDLAVVSNLTFKQVRGWFIEKRRSDK 53
                            788**************************************99998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.305155IPR001356Homeobox domain
SMARTSM003892.0E-8159IPR001356Homeobox domain
CDDcd000863.20E-9356No hitNo description
SuperFamilySSF466893.21E-10357IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-9456IPR009057Homeodomain-like
PfamPF000464.6E-7553IPR001356Homeobox domain
SMARTSM005717.8E-10385444IPR018501DDT domain
PROSITE profilePS5082712.589385444IPR018501DDT domain
PfamPF027917.9E-10386441IPR018501DDT domain
PfamPF156122.9E-6665704IPR028942WHIM1 domain
PfamPF156131.1E-11798871IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1150 aa     Download sequence    Send to blast
MKRKSQLQLQ TLLKFYAEDK YPSPRAMEDL AVVSNLTFKQ VRGWFIEKRR SDKIKNELIE  60
PPRLTKKLSV FKGRKGAAVA SDARKMLKQW ELSASNEDES NNPSSSKYKS APSEFQGRIG  120
KRKKLGLIQD LLTSDYILGK IFRKDGPPLG LEFDSLPTRA FHGCEDSRNS HPACQENQRA  180
NKRGKVSMCA AFDGQNCKES APVKKHGMGK GLMTVWRVTN PDGGDFPTGI HCGGSQITVT  240
PPISPPVSRK QPCQKKKRRQ PVSSLVKQRM LQKELQEKRK PSVRRREVES KRDEIQKQSF  300
REKCELALER LMNQECLNQF AMLVDDEELE LRELRAGTNP LTCTEHCAAN RLYGCSLCKD  360
LLAKFPPNSV KMKQPFAMQP WDSSLEAVKK LFKVFHFLYT YSVTVDICPF TLDELAQAFH  420
DKDSFLLGKI HVALLKLLLS DVETEISSGL LPHLSISCKF LALIHSVEDQ ENVVEFWKNS  480
LNPLTWTEIL CQVLIAAGFG SKQGGFRKEV LSKEMSLMVK RGLHPGTLKG ELYQLLSVQG  540
NNGSKVSDLA KSSQIMELNL AGTSDELELL ICSTLSSDIT LFEKISSSTF RLRINTLAKE  600
ASDFQSDTED SGIVHEDFHD NGAFSSSDSD CDSENSSPRN LKLIDYRKRK TRMLTFENEI  660
DESHPGEVWL LGLMEGEYSD LSIEEKLNGL VALIDLVSAG SSIRLEDLAR PTVESVPNIH  720
HGSGAKIKRS SSTKDNVPRP SWVHAGQIND TKEAYTSSKF FPVDSSVLFS KFDGKDKLSG  780
KEKEPEGMGP GINLHPMQSI FLGSDRRYNR YWLFLGPCNS YDPGHKRVYF ESSEDGHWEV  840
IDTEEALRAL LSVLDDRGKR EALLIESLEK REAFLCQEMS SRMVNDSGDQ CFKQSDQSEL  900
EIVREDSSSP VSDVDNNLTL TDIANDSLPP MGAIVLETGK KGKEENQKWN RLQQFDTWIW  960
NYFYCDLNAV KRSKRSYLES LRRCETCHDL YWRDEKHCKI CHTTFELDFD LEERYAIHSA  1020
TCRQKEDNVM FPKHKVLSSK LQSLKAAVYA IETVMPEDAL VGAWTKSAHR LWIRRLRRTS  1080
SLAELLQVVA DFVAAINEDW LFQCNLAQGS STYMEEIITC FPTMPQTSSA LALWLMKLDE  1140
LISPFLEKT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1254258KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165910.0AC216591.1 Populus trichocarpa clone POP002-D23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008202.10.0PREDICTED: uncharacterized protein LOC105113647 isoform X1
RefseqXP_011008203.10.0PREDICTED: uncharacterized protein LOC105113647 isoform X1
RefseqXP_011013124.10.0PREDICTED: uncharacterized protein LOC105117236 isoform X1
RefseqXP_011013125.10.0PREDICTED: uncharacterized protein LOC105117236 isoform X1
RefseqXP_011013126.10.0PREDICTED: uncharacterized protein LOC105117236 isoform X1
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLA0A061DLH80.0A0A061DLH8_THECC; Homeodomain-like transcriptional regulator isoform 1
TrEMBLB9SF030.0B9SF03_RICCO; Putative uncharacterized protein
STRINGPOPTR_0014s17140.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator